missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCP11L2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00 € - 624.00 €
Specifications
| Antigen | TCP11L2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18439970
|
Novus Biologicals
NBP1-82694-25ul |
25 μL |
433.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18469020
|
Novus Biologicals
NBP1-82694 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TCP11L2 Polyclonal antibody specifically detects TCP11L2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| TCP11L2 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.2) and 40% Glycerol | |
| 255394 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| MGC40368, t-complex 11 (mouse) like 2, t-complex 11 (mouse)-like 2, T-complex protein 11-like protein 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SLIDKRIKLYMRRLLCLPSPQKCMPPMPGGLAVIQQELEALGSQYANIVNLNKQVYGPFYANILRKLLFNEEAMGKVDASPPTN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title