missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TERT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 549.00 €
Specifications
| Antigen | TERT |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18255922
|
Novus Biologicals
NBP2-56116 |
100 μL |
549.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18695848
|
Novus Biologicals
NBP2-56116-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TERT Polyclonal specifically detects TERT in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TERT | |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| EST2Telomerase-associated protein 2, hEST2, TCS1EC 2.7.7.49, Telomerase catalytic subunit, telomerase reverse transcriptase, TP2HEST2, TRTEC 2.7.7 | |
| TERT | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Rabbit | |
| Autophagy, Cancer, Cellular Markers, Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Embryonic Stem Cell Markers, Mitophagy, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7015 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title