missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TGN46 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 572.00 €
Specifications
| Antigen | TGN46 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18424111
|
Novus Biologicals
NBP1-86948-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18302770
|
Novus Biologicals
NBP1-86948 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TGN46 Polyclonal specifically detects TGN46 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| TGN46 | |
| Polyclonal | |
| Rabbit | |
| Golgi Apparatus Markers, Trans golgi Network Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10618 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSWKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSAS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Unconjugated | |
| RUO | |
| Human | |
| TGN 46, TGN 48, TGN 51, TGN38, TGN-38, TGN38 homolog, TGN46, TGN-46, TGN48, TGN51, TGOLN 2, TGOLN2, trans golgi network 38, trans golgi network 46, Trans Golgi network integral membrane protein 2, Trans Golgi network integral membrane protein 2 [Precursor], Trans Golgi network protein (46 48 51kD isoforms), Trans golgi network protein 2, Trans Golgi network protein TGN51, Trans-Golgi network integral membrane protein 2, Trans-Golgi network protein 2, Trans-Golgi network protein TGN51, TTGN 2, TTGN2 | |
| TGOLN2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title