missing translation for 'onlineSavingsMsg'
Learn More
Learn More
THAP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 €
Specifications
| Antigen | THAP5 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
THAP5 Polyclonal specifically detects THAP5 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| THAP5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DKFZp313O1132, THAP domain containing 5, THAP domain-containing protein 5 | |
| THAP5 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 168451 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EDNQGKDPSKKKSQKKNLEDEKEVCPKAKSEESFVLNETKKNIVNTDVPHQHPELLHSSSLVKPPAPKTGSI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title