missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIMM13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13431
This item is not returnable.
View return policy
Description
TIMM13 Polyclonal specifically detects TIMM13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| TIMM13 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| mitochondrial import inner membrane translocase subunit Tim13, mitochondrial import inner membrane translocase subunit Tim13B, ppv1, Tim13, TIM13B, TIMM13A, TIMM13B, translocase of inner mitochondrial membrane 13 (yeast) homolog B, translocase of inner mitochondrial membrane 13 homolog (yeast) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TIMM13 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMD | |
| 0.1 mL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 26517 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction