missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TM2D2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 589.00 €
Specifications
| Antigen | TM2D2 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18443402
|
Novus Biologicals
NBP2-30462-25ul |
25ul |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18162525
|
Novus Biologicals
NBP2-30462 |
0.1 mL |
589.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TM2D2 Polyclonal specifically detects TM2D2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TM2D2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BBP-like protein 1, Beta-amyloid-binding protein-like protein 1, BLP1MGC125814, MGC125813, TM2 domain containing 2, TM2 domain-containing protein 2 | |
| TM2D2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9BX73 | |
| 83877 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TASQELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYTG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title