missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM55A Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94829-0.02ml
This item is not returnable.
View return policy
Description
TMEM55A Polyclonal antibody specifically detects TMEM55A in Mouse samples. It is validated for Western Blot
Specifications
| TMEM55A | |
| Polyclonal | |
| Western Blot 1:200-1:2000 | |
| DKFZp762O076, EC 3.1.3.78, PtdIns-4,5-P(2) 4-phosphatase type II, PtdIns-4,5-P2 4-Ptase II, transmembrane protein 55A, Type II phosphatidylinositol 4,5-bisphosphate 4-phosphatase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 130-195 of human TMEM55A (NP_061180.1). VMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSALPRRRCCAY | |
| 0.02 mL | |
| Cardiovascular Biology, Endocrinology, Signal Transduction | |
| 55529 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction