missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tmp21/p23 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | Tmp21/p23 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18699305
|
Novus Biologicals
NBP2-48969-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18622528
|
Novus Biologicals
NBP2-48969 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Tmp21/p23 Polyclonal antibody specifically detects Tmp21/p23 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Tmp21/p23 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Alzheimers Research, Neurodegeneration, Neuroscience, Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 10972 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 21 kDa transmembrane-trafficking protein, p23, P24(DELTA), p24delta, S31I125, S31III125, TMP21Tmp-21-I, transmembrane emp24 domain-containing protein 10, transmembrane emp24-like trafficking protein 10 (yeast), Transmembrane protein Tmp21,21 kDa transmembrane trafficking protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title