missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TNFAIP8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33814
This item is not returnable.
View return policy
Description
TNFAIP8 Polyclonal specifically detects TNFAIP8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| TNFAIP8 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| O95379 | |
| TNFAIP8 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI | |
| 0.1 mL | |
| Apoptosis | |
| 25816 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| GG2-1, Head and neck tumor and metastasis-related protein, MDC-3.13TNF-induced protein GG2-1, NDED, NF-kappa-B-inducible DED-containing protein, SCC-S2SCCS2, TNF alpha-induced protein 8, tumor necrosis factor alpha-induced protein 8, tumor necrosis factor, alpha-induced protein 8 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction