missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TOM70 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
280.00 € - 557.00 €
Specifications
| Antigen | TOM70 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Simple Western, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18432812
|
Novus Biologicals
NBP1-87863-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18701554
|
Novus Biologicals
NBP1-87863 |
557.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
TOM70 Polyclonal specifically detects TOM70 in Human, Mouse samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| TOM70 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| FLJ90470, KIAA0719, mitochondrial import receptor subunit TOM70, Mitochondrial precursor proteins import receptor, TOM70, Translocase of outer membrane 70 kDa subunit, translocase of outer mitochondrial membrane 70 (yeast) homolog A, translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae), translocase of outer mitochondrial membrane 70 homolog A (yeast) | |
| TOMM70 | |
| IgG | |
| Affinity Purified | |
| Specificity of human TOM70 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 ug/ml, Simple Western, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cellular Markers, Mitochondrial Markers, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9868 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title