missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 529.00 €
Specifications
| Antigen | TR alpha/NR1A1/Thyroid Hormone Receptor alpha |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18406011
|
Novus Biologicals
NBP1-90118-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18278836
|
Novus Biologicals
NBP1-90118 |
0.1 mL |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TR alpha/NR1A1/Thyroid Hormone Receptor alpha Polyclonal specifically detects TR alpha/NR1A1/Thyroid Hormone Receptor alpha in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| TR alpha/NR1A1/Thyroid Hormone Receptor alpha | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| AR7, c-ERBA-1, c-erbA-alpha, EAR7, EAR-7, EAR-7.1/EAR-7.2, ERBA, ERBA1thyroid hormone receptor, alpha (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog), ERBA-related 7, MGC000261, MGC43240, NR1A 1, NR1A1THRA3, Nuclear receptor subfamily 1 group A member 1, THRA1ERB-T-1, THRA2, thyroid hormone receptor alpha, thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a)oncogene homolog, avian), triiodothyronine receptor, V-erbA-related protein 7 | |
| THRA | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, GPCR, Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 7067 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AFEHYVNHRKHNIPHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQLGEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title