missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRAM1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94568-0.1ml
This item is not returnable.
View return policy
Description
TRAM1 Polyclonal antibody specifically detects TRAM1 in Human, Mouse samples. It is validated for Western Blot
Specifications
| TRAM1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| PNAS8, PRO1292, TRAMP, TRAMtranslocating chain-associated membrane protein 1, translocating chain-associating membrane protein, translocation associated membrane protein 1, translocation-associating membrane protein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 305-374 of human TRAM1 (NP_055109.1). CVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS | |
| 0.1 mL | |
| Immunology, Signal Transduction | |
| 23471 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction