missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Transportin 1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93233-0.02ml
This item is not returnable.
View return policy
Description
Transportin 1 Polyclonal antibody specifically detects Transportin 1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| Transportin 1 | |
| Polyclonal | |
| Western Blot 1:200-1:1000 | |
| importin beta 2, Importin beta-2, IPO2, karyopherin (importin) beta 2, MIP1Karyopherin beta-2, MIPM9 region interaction protein, transportin 1, transportin-1, TRNKPNB2importin 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 790-890 of human Transportin 1 (NP_002261.3). CPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKE | |
| 0.02 mL | |
| Apoptosis, Cancer, Cell Cycle and Replication, Cellular Markers, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, DNA replication Transcription Translation and Splicing, HIF Target Genes, Hypoxia, Neuroscience, Neurotransmission, p53 Pathway, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors | |
| 3842 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction