missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TrkA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 529.00 €
Specifications
| Antigen | TrkA |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18780244
|
Novus Biologicals
NBP2-38265 |
0.1 mL |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18604376
|
Novus Biologicals
NBP2-38265-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TrkA Polyclonal specifically detects TrkA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TrkA | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P04629 | |
| 4914 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Cancer, Immunology, Neuroscience, Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp781I14186, EC 2.7.10, EC 2.7.10.1, MTChigh affinity nerve growth factor receptor, Neurotrophic tyrosine kinase receptor type 1, neurotrophic tyrosine kinase, receptor, type 1, p140-TrkA, TRK1-transforming tyrosine kinase protein, Trk-A, TRKAOncogene TRK, TRKTRK1, tyrosine kinase receptor A | |
| NTRK1 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title