missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRM11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57607
This item is not returnable.
View return policy
Description
TRM11 Polyclonal specifically detects TRM11 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| TRM11 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| C6orf75, chromosome 6 open reading frame 75, dJ187J11.2, EC 2.1.1, EC 2.1.1.-, EC 2.1.1.113, MDS024, TRM11, TRMT11-1, tRNA guanosine-2'-O-methyltransferase TRM11 homolog, tRNA methyltransferase 11 homolog (S. cerevisiae) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 60487 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TRMT11 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGG | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering