missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tryptase epsilon/BSSP-4/PRSS22 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 589.00 €
Specifications
| Antigen | Tryptase epsilon/BSSP-4/PRSS22 |
|---|---|
| Concentration | 0.1mg/mL |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18452742
|
Novus Biologicals
NBP2-13817-25ul |
25ul |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18165580
|
Novus Biologicals
NBP2-13817 |
0.1 mL |
589.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Tryptase epsilon/BSSP-4/PRSS22 Polyclonal specifically detects Tryptase epsilon/BSSP-4/PRSS22 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Tryptase epsilon/BSSP-4/PRSS22 | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Proteases & Other Enzymes | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 64063 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: AARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| 0.1mg/mL | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| BSSP4, BSSP-4, hBSSP-4, MGC9599, prosemin, protease, serine S1 family member 22, protease, serine, 22, serine protease 22, serine protease 26, SP001LA, tryptase epsilon, UNQ302/PRO343 | |
| PRSS22 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title