missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSNAXIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | TSNAXIP1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18246604
|
Novus Biologicals
NBP2-58035 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18639848
|
Novus Biologicals
NBP2-58035-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TSNAXIP1 Polyclonal specifically detects TSNAXIP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TSNAXIP1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 55815 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAEGKNSDQLVDVLLEEIGSGLLREKDFFPGLGYGEAIPAFLRFDGLVENKKPSKKDVVNLLKDAWKERLAEEQKETFPDFFFNFLEHR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| MGC111443, translin-associated factor X interacting protein 1, translin-associated factor X-interacting protein 1, TXI1Trax-interacting protein 1 | |
| TSNAXIP1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto