missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TTC9B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00 € - 624.00 €
Specifications
| Antigen | TTC9B |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18471261
|
Novus Biologicals
NBP1-82042-25ul |
25 μL |
433.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18227215
|
Novus Biologicals
NBP1-82042 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TTC9B Polyclonal specifically detects TTC9B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TTC9B | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 148014 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:HGSARPGPTPEPSGSLGAALDSSLRAAVAFKAEGQRCYREKKFREAI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ30373, MGC33962, tetratricopeptide repeat domain 9B, tetratricopeptide repeat protein 9B, TPR repeat protein 9B | |
| TTC9B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title