missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TTLL11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 539.00 €
Tekniske data
| Antigen | TTLL11 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|
18496431
|
Novus Biologicals
NBP2-14495-25ul |
25ul |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18106731
|
Novus Biologicals
NBP2-14495 |
0.1 mL |
539.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
TTLL11 Polyclonal specifically detects TTLL11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Tekniske data
| TTLL11 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 158135 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: VRKITLSRAVRTMQNLFPEEYNFYPRSWILPDEFQLFVAQVQMVKDDDPSWKPTFIVKPDGGCQGDGIYLIKDPSDIRLAGTLQSRPAVVQEY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| bA244O19.1, C9orf20, RP11-429D3.1, TTLL11 tubulin tyrosine ligase-like family, member 11 | |
| TTLL11 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel