missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tuftelin 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
216.00 € - 624.00 €
Spezifikation
| Antigen | Tuftelin 1 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18636595
|
Novus Biologicals
NBP2-38723-25ul |
25 μL |
216.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18166349
|
Novus Biologicals
NBP2-38723 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
Tuftelin 1 Polyclonal specifically detects Tuftelin 1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| Tuftelin 1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9NNX1 | |
| 7286 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KSEVQYIQEARNCLQKLREDISSKLDRNLGDSLHRQEIQVVLEKPNGFSQSPTALYSSPPEVDTCINEDVESLRKTVQDL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| tuftelin, tuftelin 1 | |
| TUFT1 | |
| IgG | |
| Affinity Purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts