missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TYW1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | TYW1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18131959
|
Novus Biologicals
NBP2-38562 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18679195
|
Novus Biologicals
NBP2-38562-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TYW1 Polyclonal specifically detects TYW1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TYW1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ10900, MGC23001, MGC60291, Radical S-adenosyl methionine and flavodoxin domain-containing protein 1, radical S-adenosyl methionine and flavodoxin domains 1, RSAFD1, tRNA wybutosine-synthesizing protein 1 homolog, tRNA-yW synthesizing protein 1 homolog (S. cerevisiae), tRNA-yW synthesizing protein 1 homolog A, tRNA-yW-synthesizing protein, TYW1A, YPL207W | |
| TYW1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9NV66 | |
| 55253 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RELVDLIPEYEIACEHEHSNCLLIAHRKFKIGGEWWTWIDYNRFQELIQEYEDSGGSKTFSAKDYMARTPHWALFGANER | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title