missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBIAD1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94124-0.02ml
This item is not returnable.
View return policy
Description
UBIAD1 Polyclonal antibody specifically detects UBIAD1 in Human, Mouse samples. It is validated for Western Blot
Specifications
| UBIAD1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| EC 2.5.1.-, RP4-796F18.1, SCCD, Schnyder crystalline corneal dystrophy, TERE1transitional epithelia response protein, Transitional epithelial response protein 1, UbiA prenyltransferase domain containing 1, ubiA prenyltransferase domain-containing protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 250-338 of human UBIAD1 (NP_037451.1). ILIGPTFSYILYNTLLFLPYLVFSILATHCTISLALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPKI | |
| 0.02 mL | |
| Cancer | |
| 29914 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction