missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UQCR10 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93220-0.02ml
This item is not returnable.
View return policy
Description
UQCR10 Polyclonal antibody specifically detects UQCR10 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| UQCR10 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| Complex III subunit 9, Complex III subunit X, cytochrome b-c1 complex subunit 9, Cytochrome c1 non-heme 7 kDa protein, cytochrome C1, nonheme 7kDa protein, HSPC051, HSPC151, QCR9, ubiquinol-cytochrome c reductase complex (7.2 kD), ubiquinol-cytochrome c reductase, complex III subunit X, ubiquinol-cytochrome c reductase, complex III subunit X, 7.2kDa, UCCR7.2, UCRCUbiquinol-cytochrome c reductase complex 7.2 kDa protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UQCR10 (NP_037519.2). MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK | |
| 0.02 mL | |
| Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| 29796 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction