missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UQCRB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
278.00 € - 624.00 €
Specifications
| Antigen | UQCRB |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18418540
|
Novus Biologicals
NBP1-80860-25ul |
25ul |
278.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18298085
|
Novus Biologicals
NBP1-80860 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UQCRB Polyclonal specifically detects UQCRB in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| UQCRB | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 7381 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50 | |
| Polyclonal | |
| Rabbit | |
| Human, Rat, Mouse | |
| Complex III subunit 7, Complex III subunit VII, cytochrome b-c1 complex subunit 7, QCR7, QPC, QP-CFLJ92016, ubiquinol-cytochrome c reductase binding protein, Ubiquinol-cytochrome c reductase complex 14 kDa protein, ubiquinol-cytochrome c reductase, complex III subunit VI, ubiquinone-binding protein, UQBC, UQBPFLJ97033, UQCR6, UQPC | |
| UQCRB | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title