missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UQCRQ Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93506-0.02ml
This item is not returnable.
View return policy
Description
UQCRQ Polyclonal antibody specifically detects UQCRQ in Human, Mouse samples. It is validated for Western Blot
Specifications
| UQCRQ | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| complex III subunit 8, cytochrome b-c1 complex subunit 8, low molecular mass ubiquinone-binding protein (9.5kD), QPC, ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa, UQCR7 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-82 of human UQCRQ (NP_055217.2). MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK | |
| 0.02 mL | |
| Cell Biology, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| 27089 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction