missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VPS35L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Specifications
| Antigen | VPS35L |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18206435
|
Novus Biologicals
NBP2-58090 |
100 μL |
593.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643897
|
Novus Biologicals
NBP2-58090-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
VPS35L Polyclonal specifically detects VPS35L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| VPS35L | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 57020 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDFLLTFKQIHGDTVQNQLVVQGVELPSYLPLYPPAMDWIFQCISYHAPEALLTEMMERCKKLGNNALLLNSVMSAFRAEFIATRSMDFIGM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| chromosome 16 open reading frame 62, DKFZp313M0539, DKFZp434B0212, esophageal cancer associated protein, Esophageal cancer-associated protein, FLJ21040, hypothetical protein LOC57020, MGC16824 | |
| C16ORF62 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title