missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VPS36 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13518
This item is not returnable.
View return policy
Description
VPS36 Polyclonal specifically detects VPS36 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| VPS36 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| C13orf9, CGI-145, DKFZp781E0871, Eap45, EAP45chromosome 13 open reading frame 9, ELL-associated protein of 45 kDa, ELL-associated protein, 45 kDa, ESCRT-II complex subunit VPS36, vacuolar protein sorting 36 homolog (S. cerevisiae), vacuolar protein sorting 36 homolog (yeast), vacuolar protein-sorting-associated protein 36 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 51028 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| VPS36 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: AGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRG | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction