missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VRL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
285.00 € - 559.00 €
Specifications
| Antigen | VRL1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18430971
|
Novus Biologicals
NBP1-92576-25ul |
25 μL |
285.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18054177
|
Novus Biologicals
NBP1-92576 |
0.1 mL |
559.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
VRL1 Polyclonal specifically detects VRL1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| VRL1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Osm-9-like TRP channel 2, transient receptor potential cation channel, subfamily V, member 2, TrpV2, Vanilloid receptor-like protein 1, VRL-1MGC12549, VRL1transient receptor potential cation channel subfamily V member 2, VRLOTRPC2 | |
| TRPV2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 51393 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title