missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VWA3B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 572.00 €
Specifications
| Antigen | VWA3B |
|---|---|
| Dilution | Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18603336
|
Novus Biologicals
NBP2-38320-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18172238
|
Novus Biologicals
NBP2-38320 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
VWA3B Polyclonal specifically detects VWA3B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| VWA3B | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ32686, MGC26733, von Willebrand factor A domain containing 3B, von Willebrand factor A domain-containing protein 3B | |
| VWA3B | |
| IgG | |
| Affinity Purified |
| Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q502W6 | |
| 200403 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LTGGEFHFYNFGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQDLYSESLIMDWWYNAEKDGDSKHQKEICSMISTPEKCAKP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title