missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WAPL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-92578
This item is not returnable.
View return policy
Description
WAPL Polyclonal specifically detects WAPL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| WAPL | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| FOEKIAA0261friend of EBNA2 (Epstein-Barr virus nuclear protein 2), Friend of EBNA2 protein, WAPLwings apart-like protein homolog, wings apart-like homolog (Drosophila) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| WAPAL | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IVTALKCRREDKELYTVVQHVKHFNDVVEFGENQEFTDDIEYLLSGLKSTQPLNTRCLSVISLATKCAMPSFRMHLR | |
| 0.1 mL | |
| DNA Repair | |
| 23063 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction