missing translation for 'onlineSavingsMsg'
Learn More
Learn More
YARS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | YARS2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18268951
|
Novus Biologicals
NBP2-56297 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18603527
|
Novus Biologicals
NBP2-56297-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
YARS2 Polyclonal specifically detects YARS2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| YARS2 | |
| Polyclonal | |
| Rabbit | |
| Proteases & Other Enzymes | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 51067 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DALEVMSDQELKELFKEAPFSEFFLDPGTSVLDTCRKANAIPDGPRGYRMITEGGVSINHQQVTNPESVLIVGQHILKNGLSL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| CGI-04, EC 6.1.1.1, FLJ13995, MLASA2, MT-TYRRS, tyrosine tRNA ligase 2, mitochondrial, Tyrosine--tRNA ligase, tyrosyl-tRNA synthetase 2, mitochondrial, tyrosyl-tRNA synthetase, mitochondrial, TYRRS | |
| YARS2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title