missing translation for 'onlineSavingsMsg'
Learn More

ZDHHC24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-86450

View more versions of this product

Product Code. 18212628

572.00 € / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

ZDHHC24 Polyclonal specifically detects ZDHHC24 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	ZDHHC24
Classification	Polyclonal
Dilution	Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	DHHC-24, EC 2.3.1.-, probable palmitoyltransferase ZDHHC24, Zinc finger DHHC domain-containing protein 24, zinc finger, DHHC domain containing 24, zinc finger, DHHC-type containing 24
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	254359
Target Species	Human
Isotype	IgG

Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	ZDHHC24
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:HGMLLLRGQTTWEWARGQHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTAS
Quantity	0.1 mL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Product Suggestions

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

ZDHHC24 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions