missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZDHHC7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56799-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
ZDHHC7 Polyclonal specifically detects ZDHHC7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spécification
| ZDHHC7 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| EC 2.3.1, EC 2.3.1.-, FLJ10792, FLJ20279, palmitoyltransferase ZDHHC7, Sertoli cell gene with zinc finger domain- and #946, SERZ1, SERZ-B, Zinc finger DHHC domain-containing protein 7, Zinc finger protein 370, zinc finger, DHHC domain containing 7, zinc finger, DHHC-type containing 7, ZNF370DHHC-7 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 55625 | |
| Human | |
| Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| ZDHHC7 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu