missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZEB2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 17 publications
378.00 € - 572.00 €
Specifications
| Antigen | ZEB2 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Flow Cytometry, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated |
| Applications | Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18460071
|
Novus Biologicals
NBP1-82991-25ul |
25 μL |
378.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18729663
|
Novus Biologicals
NBP1-82991 |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
ZEB2 Polyclonal specifically detects ZEB2 in Human, Mouse samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| ZEB2 | |
| Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| KIAA0569FLJ42816, SIP1HSPC082, Smad-interacting protein 1, SMADIP1ZFHX1BSIP-1, ZFX1B, zinc finger E-box binding homeobox 2, zinc finger E-box-binding homeobox 2, zinc finger homeobox 1b, Zinc finger homeobox protein 1b | |
| ZEB2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human ZEB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/ml, Flow Cytometry, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Neuroscience, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9839 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title