missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF384 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94454-0.1ml
This item is not returnable.
View return policy
Description
ZNF384 Polyclonal antibody specifically detects ZNF384 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ZNF384 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| CAG repeat protein 1, CAG/CTG 2, Cas-interacting zinc finger protein, zinc finger protein 384 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ZNF384 (NP_001129206.1). MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHS | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 171017 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction