missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF607 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00 €
Specifications
| Antigen | ZNF607 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Beskrivning
ZNF607 Polyclonal specifically detects ZNF607 in Human samples. It is validated for Western Blot.Specifikationer
| ZNF607 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ14802, MGC13071, zinc finger protein 607 | |
| ZNF607 | |
| IgG | |
| 81 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_116078 | |
| 84775 | |
| Synthetic peptide directed towards the middle region of human ZNF607. Peptide sequence KECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFESV. | |
| Primary |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel