missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF670 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00 €
Specifications
| Antigen | ZNF670 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF670 Polyclonal specifically detects ZNF670 in Human samples. It is validated for Western Blot.Specifications
| ZNF670 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ12606, MGC12466, zinc finger protein 670 | |
| ZNF670 | |
| IgG | |
| 44 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_149990 | |
| 93474 | |
| Synthetic peptide directed towards the N terminal of human ZNF670. Peptide sequence EIFRNLASVGNKSEDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title