missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF842 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
466.00 €
Specifications
| Antigen | ZNF842 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF842 Polyclonal specifically detects ZNF842 in Human samples. It is validated for Western Blot.Specifications
| ZNF842 | |
| Polyclonal | |
| Rabbit | |
| ZNF842 zinc finger protein 842 | |
| ZNF799 | |
| IgG | |
| 71 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 90576 | |
| Synthetic peptide directed towards the middle region of human ZNF799. Peptide sequence AFPDYSSCLRHERTHTGKKPYTCKQCGKAFSASTSLRRHETTHTDEKPYA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title