missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF850 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 539.00 €
Specifications
| Antigen | ZNF850 |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18440212
|
Novus Biologicals
NBP2-34185-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18100834
|
Novus Biologicals
NBP2-34185 |
0.1 mL |
539.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZNF850 Polyclonal specifically detects ZNF850 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ZNF850 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Putative Zinc Finger Protein ENSP00000330994, Zinc Finger Protein 850, Zinc Finger Protein 850 (Pseudogene), Zinc Finger Protein 850 Pseudogene, ZNF850P | |
| ZNF850 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| A8MQ14 | |
| 342892 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VMFQDLSIDFSQEEWECLDAAQKDLYRDVMMENYSSLVSLGLSIPKPDVISLLEQGKEPWMVSRDVLGGWCRDERPH | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title