missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NDUFB5 Antibody, Novus Biologicals™

NDUFB5 Antibody, Novus Biologicals™

Product Code. 30230098 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30230098 20 μL 20µL
30231478 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30230098 Supplier Novus Biologicals Supplier No. NBP33794120ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NDUFB5 Polyclonal antibody specifically detects NDUFB5 in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NDUFB5
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias 5 (16kD, SGDH), CISGDH, CI-SGDH, Complex I-SGDH, DKFZp686N02262, FLJ30597, MGC111204, MGC12314, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial, SGDH
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-189 of human NDUFB5 (NP_002483.1).,, Sequence:, EIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Purification Method Affinity purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4711
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.