missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CT45A1 Polyclonal antibody specifically detects CT45A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | CT45A1 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS (pH 7.2), 40% Glycerol |
| Gene Accession No. | Q8N7B7 |
| Gene Alias | Cancer/testis antigen 45-1, Cancer/testis antigen 45A1, cancer/testis antigen CT45-1, cancer/testis antigen family 45 member A1, cancer/testis antigen family 45, member A1, CT45, CT45.1, CT45-1XX-FW88277B6.1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?