missing translation for 'onlineSavingsMsg'
Learn More

Human Coronavirus Spike S1 Antibody [Janelia Fluor« 549], Novus Biologicals Biologicals™

Product Code. 30487241 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30487241 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30487241 Supplier Novus Biologicals Supplier No. NBP337887JF549

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Human Coronavirus Spike S1 Polyclonal antibody specifically detects Human Coronavirus Spike S1 in HCoV-229E samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Human Coronavirus Spike S1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Janelia Fluor 549
Formulation 50mM Sodium Borate
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1074-1173 of coronavirus Spike S1 (NP_073551.1).,, Sequence:, TGRGDCKGFSSDVLSDVIRYNLNFEENLRRGTILFKTSYGVVVFYCTNNTLVSGDAHIPFGTVLGNFYCFVNTTIGNETTSAFVGALPKTVREFVISRTGH
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Target Species HCoV-229E
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.