missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HOXA7 Polyclonal antibody specifically detects HOXA7 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | HOXA7 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | DyLight 650 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | ANTP, homeo box A7, homeobox A7, Homeobox protein Hox 1.1, Homeobox protein Hox-1A, homeobox protein Hox-A7, HOX1.1, HOX1AHOX1 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human HOXA7 (NP_008827.2).,, Sequence:, MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIY |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?