missing translation for 'onlineSavingsMsg'
Learn More

PCAF Antibody [Alexa Fluor« 647], Novus Biologicals Biologicals™

Product Code. 30489204 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30489204 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30489204 Supplier Novus Biologicals Supplier No. NBP335063AF647

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PCAF Polyclonal antibody specifically detects PCAF in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen PCAF
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Alexa Fluor 647
Formulation 50mM Sodium Borate
Gene Alias CREBBP-associated factor, EC 2.3.1.48, GCN5L, Histone acetylase PCAF, histone acetyltransferase KAT2B, Histone acetyltransferase PCAF, K(lysine) acetyltransferase 2B, Lysine acetyltransferase 2B, P, P/CAFGCN5, P300/CBP-associated factorCAF, PCAF
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human PCAF (NP_003875.3).,, Sequence:, MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAP
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication, Cellular Markers, Chromatin Research, HIF Target Genes, Hypoxia, Membrane Trafficking and Chaperones, Signal Transduction, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 8850
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.