missing translation for 'onlineSavingsMsg'
Learn More

XRCC2 Antibody [mFluor Violet 450 SE], Novus Biologicals Biologicals™

Product Code. 30490018 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity
30490018 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30490018 Supplier Novus Biologicals Supplier No. NBP335804MFV450

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

XRCC2 Polyclonal antibody specifically detects XRCC2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen XRCC2
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate mFluor Violet 450 SE
Formulation 50mM Sodium Borate
Gene Alias DKFZp781P0919, DNA repair protein XRCC2, X-ray repair complementing defective repair in Chinese hamster cells 2, X-ray repair cross-complementing protein 2, X-ray repair, complementing defective, repair in Chinese hamster
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human XRCC2 (NP_005422.1).,, Sequence:, MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDT
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, DNA Repair, Homologous Recombination, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 7516
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.