missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Spike Polyclonal antibody specifically detects Spike in SARS-CoV samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | Spike |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | DyLight 488 |
| Formulation | 50mM Sodium Borate |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 600-700 of coronavirus Spike (NP_828851.1).,, Sequence:, DVNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNF |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Regulatory Status | RUO |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?