missing translation for 'onlineSavingsMsg'
Learn More

Caspase-4 Antibody [DyLight 550], Novus Biologicals Biologicals™

Product Code. 30492416 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30492416 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30492416 Supplier Novus Biologicals Supplier No. NBP335895R

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Caspase-4 Polyclonal antibody specifically detects Caspase-4 in Human samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Caspase-4
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate DyLight 550
Formulation 50mM Sodium Borate
Gene Alias apoptotic cysteine protease Mih1/TX, CASP-4, caspase 4, apoptosis-related cysteine peptidase, caspase 4, apoptosis-related cysteine protease, caspase-4, EC 3.4.22, EC 3.4.22.57, ICE(rel)II, ICE(rel)-II, ICEREL-II, ICH2, ICH-2, Mih1/TX, Protease ICH-2, Protease TX, TX
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 81-270 of human Caspase-4 (NP_001216.1).,, Sequence:, SDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Caspases
Primary or Secondary Primary
Gene ID (Entrez) 837
Target Species Human
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.