missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Caspase-4 Polyclonal antibody specifically detects Caspase-4 in Human samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Caspase-4 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | DyLight 550 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | apoptotic cysteine protease Mih1/TX, CASP-4, caspase 4, apoptosis-related cysteine peptidase, caspase 4, apoptosis-related cysteine protease, caspase-4, EC 3.4.22, EC 3.4.22.57, ICE(rel)II, ICE(rel)-II, ICEREL-II, ICH2, ICH-2, Mih1/TX, Protease ICH-2, Protease TX, TX |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 81-270 of human Caspase-4 (NP_001216.1).,, Sequence:, SDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?