missing translation for 'onlineSavingsMsg'
Learn More

MYF6 Antibody [Alexa Fluor« 750], Novus Biologicals Biologicals™

Product Code. 30494427 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30494427 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30494427 Supplier Novus Biologicals Supplier No. NBP335524AF750

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

MYF6 Polyclonal antibody specifically detects MYF6 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen MYF6
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 750
Formulation 50mM Sodium Borate
Gene Alias bHLHc4BHLHC4, Class C basic helix-loop-helix protein 4, MRF4, MRF4myogenic factor 6, Muscle-specific regulatory factor 4, Myf-6, myogenic factor 6 (herculin)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human MYF6 (NP_002460.1).,, Sequence:, WACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4618
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.