missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HNF1 Polyclonal antibody specifically detects HNF1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | HNF1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | DyLight 680 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | HNF1 homeobox A, IDDM20, LFB1transcription factor 1, hepatic; LF-B1, hepatic nuclear factor (HNF1), albuminproximal factor, MODY3, TCF1hepatic, Transcription factor 1 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human HNF1 (NP_000536.6).,, Sequence:, GEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNI |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?