missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NRAMP2/SLC11A2/DMT1 Antibody [Alexa Fluor« 647], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
NRAMP2/SLC11A2/DMT1 Polyclonal antibody specifically detects NRAMP2/SLC11A2/DMT1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | NRAMP2/SLC11A2/DMT1 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 647 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | DCT1NRAMP 2, Divalent cation transporter 1, Divalent metal transporter 1, DMT-1, DMT1FLJ37416, member 2, NRAMP2natural resistance-associated macrophage protein 2, solute carrier family 11 (proton-coupled divalent metal ion transporters) |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human NRAMP2/SLC11A2/DMT1 (NP_001167597.1).,, Sequence:, MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?